EGF
EGF
Product Name: | Recombinant Human EGF Protein |
Description: | Recombinant human EGF is a bioactive growth factor protein intended for use in cell culture applications. Epidermal Growth Factor (EGF) plays an important role in the regulation of cell growth, proliferation, and differentiation of specific cells in vivo and serves as a potent mitogenic factor for a variety of culture cells of both ectodermal and mesodermal origin. The SBD recombinant human EGF is 6.2 kDa protein consisting of 54 amino acid residues. |
Available Sizes: | 10ug, 25ug, 100ug, 500ug |
Catalog Number: | 12-0003-10,12-0003-25,12-0003-100,12-0003-500 |
AA Sequence: | MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
Source: | Escherichia Coli. |
Purity: | Greater than 98%, as determined by SDS-PAGE |
Endotoxin: | < 1.0 EU/ μg of protein as determined by the LAL assay |
Storage: | Store under sterile conditions in the lyophilized form for up to 12 months at- 70°C. |
Formulation: | Sterile filtered through a 0.2 micron filter and lyophilized from sterile filtered 1X PBS, pH 7.4. |
Download: |
Updating...